PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005217-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YB
Protein Properties Length: 186aa    MW: 19937.1 Da    PI: 6.5392
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005217-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.96.3e-5822117297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+k+re+ege+
  NNU_005217-RA  22 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQKFREMEGER 117
                    89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.2E-5616129IPR009072Histone-fold
SuperFamilySSF471132.17E-4124130IPR009072Histone-fold
PfamPF008085.0E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-215573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-217492No hitNo description
PRINTSPR006151.6E-2193111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MADSDNESGG QYNNANSEMS PREQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYV EPLKIYLQKF REMEGERSSM  120
GRQGEKDGSG GGGSAGGGNG GVVNPGSGSS SGGFNGGGMY GGVQSAMMMM GHHQGQVYGS  180
GRKRRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B1e-4919112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-4919112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252766.11e-131PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233105e-75NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA5C8J32e-95A5C8J3_VITVI; Putative uncharacterized protein
TrEMBLD7UAG51e-103D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t011e-103(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.16e-74nuclear factor Y, subunit B3